PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_34699-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 85aa    MW: 9731.03 Da    PI: 8.5131
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_34699-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.91.3e-192067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd llv++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  TRIUR3_34699-P1 20 RGPWTVEEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYL 67
                     89*********************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.2671571IPR017930Myb domain
SuperFamilySSF466891.96E-191778IPR009057Homeodomain-like
SMARTSM007172.1E-151969IPR001005SANT/Myb domain
PfamPF002499.6E-182067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-232184IPR009057Homeodomain-like
CDDcd001671.86E-122267No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MAHERDSSSE EEVMAGDLRR GPWTVEEDIL LVNYIAAHGE GRWNSLARSA GLKRTGKSCR  60
LRWLNYLRPD LRRGSITPQE QLLIP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519091e-134JF951909.1 Triticum aestivum clone TaMYB26 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561685.11e-53PREDICTED: myb-related protein P-like
SwissprotP813916e-39MYB05_ANTMA; Myb-related protein 305
TrEMBLT1NV218e-57T1NV21_TRIUA; Uncharacterized protein
STRINGMLOC_17928.23e-54(Hordeum vulgare)
STRINGBRADI1G64140.14e-53(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.13e-39myb domain protein 24